Iright
BRAND / VENDOR: Proteintech

Proteintech, 66868-1-Ig, CD8a Monoclonal antibody

CATALOG NUMBER: 66868-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CD8a (66868-1-Ig) by Proteintech is a Monoclonal antibody targeting CD8a in WB, IHC, IF-P, ELISA applications with reactivity to human samples 66868-1-Ig targets CD8a in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MOLT-4 cells, human peripheral blood leukocyte Positive IHC detected in: human tonsillitis tissue, human appendicitis tissue, human breast cancer tissue, human colon cancer tissue, human lung cancer tissue, human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human tonsillitis tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:10000-1:40000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information CD8 is a transmembrane glycoprotein that is predominantly expressed on the surface of cytotoxic T cells, and can also be found on natural killer cells, cortical thymocytes, and dendritic cells. CD8 serves as a co-receptor for the T cell receptor (TCR). Both CD8 and TCR recognize antigens displayed by an antigen presenting cell (APC) in the context of class I MHC molecules. CD8 plays a role in T cell development and activation of mature T cells. This antibody is raised against 23-183 aa of human CD8a, the alpha chain of CD8 molecule. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag11111 Product name: Recombinant human CD8A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 23-183 aa of BC025715 Sequence: QFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGCYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDI Predict reactive species Full Name: CD8a molecule Calculated Molecular Weight: 235 aa, 26 kDa Observed Molecular Weight: 32 kDa GenBank Accession Number: BC025715 Gene Symbol: CD8A Gene ID (NCBI): 925 ENSEMBL Gene ID: ENSG00000153563 RRID: AB_2882205 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P01732 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924