Proteintech, 66881-1-Ig, Flotillin 2 Monoclonal antibody

Size: 20ul / 150ul The Flotillin 2 (66881-1-Ig) by Proteintech is a Monoclonal antibody targeting Flotillin 2 in WB, IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human, mouse, rat, pig, rabbit samples 66881-1-Ig targets Flotillin 2 in WB, IHC, IF/ICC, FC (Intra), CoIP, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples. Tested Applications Positive WB detected in: pig brain tissue, A431 cells, HeLa cells, HEK-293 cells, A549 cells, NIH/3T3 cells, rabbit brain tissue, rat brain tissue, mouse brain tissue Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:20000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:2000-1:8000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information Flotillins are membrane-associated proteins that contain two homologous isoforms, flotillin 1 (FLOT1) and flotillin 2 (FLOT2). They are highly conserved and widely expressed proteins that commonly used as markers of lipid rafts. Flotillins are involved in various signaling pathways, cell adhesion, membrane trafficking and axonal growth. Specification Tested Reactivity: human, mouse, rat, pig, rabbit Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag28308 Product name: Recombinant human Flotillin 2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-379 aa of BC017292 Sequence: MTLQPRCEDVETAEGVALTVTGVAQVKIMTEKELLAVACEQFLGKNVQDIKNVVLQTLEGHLRSILGTLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGKTQTAVVQRDADIGVAEAERDAGIREAECKKEMLDVKFMADTKIADSKRAFELQKSAFSEEVNIKTAEAQLAYELQGAREQQKIRQEEIEIEVVQRKKQIAVEAQEILRTDKELIATVRRPAEAEAHRIQQIAEGEKVKQVLLAQAEAEKIRKIGEAEAAVIEAMGKAEAERMKLKAEAYQKYGDAAKMALVLEALPQIAAKIAAPLTKVDEIVVLSGDNSKVTSEVNRLLAELPASVHALTGVDLSKIPLIKKATGVQV Predict reactive species Full Name: flotillin 2 Calculated Molecular Weight: 379 aa, 42 kDa Observed Molecular Weight: 45 kDa GenBank Accession Number: BC017292 Gene Symbol: Flotillin 2 Gene ID (NCBI): 2319 RRID: AB_2882213 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q14254 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.