Iright
BRAND / VENDOR: Proteintech

Proteintech, 66905-1-Ig, GLI1 Monoclonal antibody

CATALOG NUMBER: 66905-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The GLI1 (66905-1-Ig) by Proteintech is a Monoclonal antibody targeting GLI1 in WB, ELISA applications with reactivity to human, mouse, rat, pig samples 66905-1-Ig targets GLI1 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: A549 cells, C6 cells, HEK-293 cells, human testis tissue, 4T1 cells, mouse brain tissue, NCI-H1299 cells, PC-3 cells, MCF-7 cells, MDA-MB-231 cells, pig brain tissue, rat brain tissue, BxPC-3 cells, U-251 cells, mouse liver tissue, rat liver tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:20000 Background Information GLI1, also known as Glioma-associated oncogene, is a 1106 amino acid protein, which belongs to the GLI C2H2-type zinc-finger protein family. GLI1 is detected in testis and Also expressed in the brain with highest expression in the cerebellum, optic nerve and olfactory tract. GLI1 is tethered in the cytoplasm by binding to SUFU (PubMed:10806483). GLI1 is activated and translocated to the nucleus promoted by interaction with STK36 (PubMed:10806483). Phosphorylation of GLI1 by ULK3 may promote nuclear localization (PubMed:19878745). GLI1 as a transcriptional activator may regulate the transcription of specific genes during normal development (PubMed:19706761). GLI1 plays a role in craniofacial development and digital development, as well as development of the central nervous system and gastrointestinal tract and Mediates SHH signaling (PubMed:19706761). GLI1 plays a role in cell proliferation and differentiation via its role in SHH signaling. Specification Tested Reactivity: human, mouse, rat, pig Cited Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag27832 Product name: Recombinant human GLI1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 470-659 aa of BC013000 Sequence: NAGGSTEDLSSLDEGPCIAGTGLSTLRRLENLRLDQLHQLRPIGTRGLKLPSLSHTGTTVSRRVGPPVSLERRSSSSSSISSAYTVSRRSSLASPFPPGSPPENGASSLPGLMPAQHYLLRARYASARGGGTSPTAASSLDRIGGLPMPPWRSRAEYPGYNPNAGVTRRASDPAQAADRPAPARVQRFKS Predict reactive species Full Name: GLI family zinc finger 1 Calculated Molecular Weight: 1106 aa, 118 kDa Observed Molecular Weight: 150 kDa GenBank Accession Number: BC013000 Gene Symbol: GLI1 Gene ID (NCBI): 2735 RRID: AB_2882232 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P08151 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924