Proteintech, 66908-1-Ig, C7 Monoclonal antibody

Size: 20ul / 150ul The C7 (66908-1-Ig) by Proteintech is a Monoclonal antibody targeting C7 in WB, IF/ICC, ELISA applications with reactivity to human samples 66908-1-Ig targets C7 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human plasma tissue Positive IF/ICC detected in: HepG2 cells Positive FC (Intra) detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension Background Information C7, a single-chain plasma glycoprotein, is a component of the complement system. It is a constituent of the membrane attack complex (MAC) that plays a key role in the innate and adaptive immune response by forming pores in the plasma membrane of target cells. C7 serves as a membrane anchor. People with C7 deficiency are prone to bacterial infection. Specification Tested Reactivity: human Cited Reactivity: pig Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag12552 Product name: Recombinant human C7 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 310-690 aa of BC063851 Sequence: GGEYRVLFYVDSEKLKQNDFNSVEEKKCKSSGWHFVVKFSSHGCKELENALKAASGTQNNVLRGEPFIRGGGAGFISGLSYLELDNPAGNKRRYSAWAESVTNLPQVIKQKLTPLYELVKEVPCASVKKLYLKWALEEYLDEFDPCHCRPCQNGGLATVEGTHCLCHCKPYTFGAACEQGVLVGNQAGGVDGGWSCWSSWSPCVQGKKTRSRECNNPPPSGGGRSCVGETTESTQCEDEELEHLRLLEPHCFPLSLVPTEFCPSPPALKDGFVQDEGTMFPVGKNVVYTCNEGYSLIGNPVARCGEDLRWLVGEMHCQKIACVLPVLMDGIQSHPQKPFYTVGEKVTVSCSGGMSLEGPSAFLCGSSLKWSPEMKNARCVQ Predict reactive species Full Name: complement component 7 Calculated Molecular Weight: 843 aa, 94 kDa Observed Molecular Weight: 100 kDa GenBank Accession Number: BC063851 Gene Symbol: C7 Gene ID (NCBI): 730 RRID: AB_2882235 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P10643 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.