Proteintech, 66913-1-Ig, CD155/PVR Monoclonal antibody

Size: 20ul / 150ul The CD155/PVR (66913-1-Ig) by Proteintech is a Monoclonal antibody targeting CD155/PVR in WB, ELISA applications with reactivity to human samples 66913-1-Ig targets CD155/PVR in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: U2OS cells, K-562 cells, HT-1080 cells, U-251 cells, A549 cells, HT-29 cells, HepG2 cells, HeLa cells, HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information CD155, also known as PVR, is a type I transmembrane glycoprotein in the immunoglobulin superfamily. It contains three extracellular immunoglobulin-like domains, D1-D3, of which D1 is recognized by the virus. Mature human CD155 consists of a 323 amino acid extracellular domain with one N-terminal V-type and two C2-type Ig-like domains, a 24 amino acid transmembrane segment, and a 50 amino acid cytoplasmic tail. CD155 is thought to play a role in adhesion by interaction with the ECM component vitronectin as well as a role in NK killing of tumor cells. CD155 binds to two receptors of NK cells, CD96 and CD226, and accumulates at cell-cell contact sites, leading to the formation of mature immune synapses between NK cells and target cells. CD155 serves as the entry receptor for poliovirus and thereby mediates human susceptibility to poliovirus infection. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag28303 Product name: Recombinant human PVR protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 21-115 aa of BC015542 Sequence: WPPPGTGDVVVQAPTQVPGFLGDSVTLPCYLQVPNMEVTHVSQLTWARHGESGSMAVFHQTQGPSYSESKRLEFVAARLGAELRNASLRMFGLRV Predict reactive species Full Name: poliovirus receptor Calculated Molecular Weight: 45 kDa Observed Molecular Weight: 60-70 kDa GenBank Accession Number: BC015542 Gene Symbol: CD155/PVR Gene ID (NCBI): 5817 RRID: AB_2882240 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P15151 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.