Iright
BRAND / VENDOR: Proteintech

Proteintech, 66926-1-Ig, GPNMB Monoclonal antibody

CATALOG NUMBER: 66926-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The GPNMB (66926-1-Ig) by Proteintech is a Monoclonal antibody targeting GPNMB in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 66926-1-Ig targets GPNMB in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: SK-BR-3 cells, A549 cells, HT-1080 cells, RT-4 cells, MG-63 cells, FaDu cells, MDA-MB-468 cells, PC-12 cells, RAw 264.7 cells, 4T1 cells, HeLa cells, A375 cells, U-251 cells, THP-1 cells, U-937 cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500 Background Information GPNMB also known as HGFIN, osteoactivin, and DC-HIL, is a type I membrane glycoprotein involved in various biological processes, including inflammation, invasion and metastasis of malignant tumors, cell differentiation, and tissue regeneration. GPNMB shows expression in the lowly metastatic human melanoma cell lines and xenografts but does not show expression in the highly metastatic cell lines. GPNMB acts as an osteogenic factor that stimulates osteoblast differentiation in vivo and in vitro. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag26747 Product name: Recombinant human GPNMB protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 38-158 aa of BC011595 Sequence: MREHNQLNGWSSDENDWNEKLYPVWKRGDMRWKNSWKGGRVQAVLTSDSPALVGSNITFAVNLIFPRCQKEDANGNIVYEKNCRNEAGLSADPYVYNWTAWSEDSDGENGTGQSHHNVFPD Predict reactive species Full Name: glycoprotein (transmembrane) nmb Calculated Molecular Weight: 64 kDa Observed Molecular Weight: 64-70 kDa GenBank Accession Number: BC011595 Gene Symbol: GPNMB Gene ID (NCBI): 10457 RRID: AB_2882253 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q14956 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924