Iright
BRAND / VENDOR: Proteintech

Proteintech, 66951-1-Ig, DBR1 Monoclonal antibody

CATALOG NUMBER: 66951-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The DBR1 (66951-1-Ig) by Proteintech is a Monoclonal antibody targeting DBR1 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to Human, Mouse, Rat, Pig samples 66951-1-Ig targets DBR1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with Human, Mouse, Rat, Pig samples. Tested Applications Positive WB detected in: human brain tissue, HeLa cells, MCF-7 cells, fetal human brain tissue, pig brain tissue, rat brain tissue, mouse brain tissue, HepG2 cells Positive IP detected in: HeLa cells, mouse brain tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information DBR1(Lariat debranching enzyme) hydrolyzes 2-prime-to-5-prime branched phosphodiester bonds at the branch point of excised lariat intron RNA and converts them into linear molecules. DBR1 belongs to the lariat debranching enzyme family. Inhibiton of Dbr1 can suppress TDP-43 toxicity in primary neurons, suggesting that Dbr1 could be a potential therapeutic target for ALS and related TDP-43 proteinopathies (PMID: 23104007). This protein has 2 isoforms produced by alternative splicing. Specification Tested Reactivity: Human, Mouse, Rat, Pig Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag8830 Product name: Recombinant human DBR1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 204-544 aa of BC009472 Sequence: TLGSPAASELLEHLKPTYWFSAHLHVKFAALMQHQAKDKGQTARATKFLALDKCLPHRDFLQILEIEHDPSAPDYLEYDIEWLTILRATDDLINVTGRLWNMPENNGLHARWDYSATEEGMKEVLEKLNHDLKVPCNFSVTAACYDPSKPQTQMQLIHRINPQTTEFCAQLGIIDINVRLQKSKEEHHVCGEYEEQDDVESNDSGEDQSEYNTDTSALSSINPDEIMLDEEEDEDSIVSAHSGMNTPSVEPSDQASEFSASFSDVRILPGSMIVSSDDTVDSTIDREGKPGGTVESGNGEDLTKVPLKRLSDEHEPEQRKKIKRRNQAIYAAVDDDDDDAA Predict reactive species Full Name: debranching enzyme homolog 1 (S. cerevisiae) Calculated Molecular Weight: 544 aa, 62 kDa Observed Molecular Weight: 70-80 kDa GenBank Accession Number: BC009472 Gene Symbol: DBR1 Gene ID (NCBI): 51163 RRID: AB_2882274 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9UK59 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924