Proteintech, 66952-1-Ig, CD61 / Integrin beta 3 Monoclonal antibody

Size: 20ul / 150ul The CD61 / Integrin beta 3 (66952-1-Ig) by Proteintech is a Monoclonal antibody targeting CD61 / Integrin beta 3 in WB, IHC, ELISA applications with reactivity to Human samples 66952-1-Ig targets CD61 / Integrin beta 3 in WB, IP, IHC, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: HUVEC cells, human placenta tissue Positive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Background Information Integrin beta-3, also named as CD61 and GPIIIa, is a receptor for cytotactin, fibronectin, laminin, matrix metalloproteinase-2, osteopontin, osteomodulin, prothrombin, thrombospondin, vitronectin and von Willebrand factor. Integrin beta-3 recognize the sequence R-G-D in a wide array of ligands and the sequence H-H-L-G-G-G-A-K-Q-A-G-D-V in fibrinogen gamma chain. Following activation integrin beta-3 brings about platelet/platelet interaction through binding of soluble fibrinogen which leads to rapid platelet aggregation which physically plugs ruptured endothelial surface. In case of HIV-1 infection, the interaction with extracellular viral Tat protein seems to enhance angiogenesis in Kaposi's sarcoma lesions. Human integrin beta-3 has a calculated molecular weight of 87 kDa. As a result of glycosylation, the apparent molecular mass of integrin beta-3 is approximately 90-110 kDa. Specification Tested Reactivity: Human Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag27834 Product name: Recombinant human ITGB3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 634-718 aa of BC127666 Sequence: CTFKKECVECKKFDRGALHDENTCNRYCRDEIESVKELKDTGKDAVNCTYKNEDDCVVRFQYYEDSSGKSILYVVEEPECPKGPD Predict reactive species Full Name: integrin, beta 3 (platelet glycoprotein IIIa, antigen CD61) Calculated Molecular Weight: 788 aa, 87 kDa Observed Molecular Weight: 100-110 kDa GenBank Accession Number: BC127666 Gene Symbol: Integrin beta 3 Gene ID (NCBI): 3690 RRID: AB_2882275 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P05106 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.