Iright
BRAND / VENDOR: Proteintech

Proteintech, 66957-1-Ig, LXN Monoclonal antibody

CATALOG NUMBER: 66957-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The LXN (66957-1-Ig) by Proteintech is a Monoclonal antibody targeting LXN in WB, IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human, pig, rabbit samples 66957-1-Ig targets LXN in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, pig, rabbit samples. Tested Applications Positive WB detected in: pig brain tissue, A549 cells, HEK-293 cells, SH-SY5Y cells, rabbit brain tissue, HeLa cells Positive IHC detected in: human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information Latexin, also named as LTXN, LXN, ECI, MUM and TCI, is hardly reversible, non-competitive, and potent inhibitor of CPA1, CPA2 and CPA4. It may function as a neuroprotective mechanism against tau toxicity. Specification Tested Reactivity: human, pig, rabbit Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag27922 Product name: Recombinant human LXN protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-222 aa of BC005346 Sequence: MEIPPTNYPASRAALVAQNYINYQQGTPHRVFEVQKVKQASMEDIPGRGHKYRLKFAVEEIIQKQVKVNCTAEVLYPSTGQETAPEVNFTFEGETGKNPDEEDNTFYQRLKSMKEPLEAQNIPDNFGNVSPEMTLVLHLAWVACGYIIWQNSTEDTWYKMVKIQTVKQVQRNDDFIELDYTILLHNIASQEIIPWQMQVLWHPQYGTKVKHNSRLPKEVQLE Predict reactive species Full Name: latexin Calculated Molecular Weight: 222 aa, 26 kDa Observed Molecular Weight: 30 kDa GenBank Accession Number: BC005346 Gene Symbol: LXN Gene ID (NCBI): 56925 RRID: AB_2882280 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9BS40 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924