Proteintech, 66959-1-Ig, RRAS Monoclonal antibody

Size: 20ul / 150ul The RRAS (66959-1-Ig) by Proteintech is a Monoclonal antibody targeting RRAS in WB, ELISA applications with reactivity to Human, mouse, Rat samples 66959-1-Ig targets RRAS in WB, ELISA applications and shows reactivity with Human, mouse, Rat samples. Tested Applications Positive WB detected in: A549 cells, PC-3 cells, HT-29 cells, HSC-T6 cells, NIH/3T3 cells Recommended dilution Western Blot (WB): WB : 1:4000-1:8000 Background Information RRAS belongs to the Ras subfamily of small G-proteins, which are frequently implicated in cell growth and differentiation.RRAS is a small GTPase involved in diverse processes including angiogenesis, vascular homeostasis and regeneration, cell adhesion, and neuronal axon guidance. Mutations in this gene are found in many invasive cancers. Specification Tested Reactivity: Human, mouse, Rat Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag26564 Product name: Recombinant human RRAS protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 145-218 aa of BC016318 Sequence: DLESQRQVPRSEASAFGASHHVAYFEASAKLRLNVDEAFEQLVRAVRKYQEQELPPSPPSAPRKKGGGCPCVLL Predict reactive species Full Name: related RAS viral (r-ras) oncogene homolog Calculated Molecular Weight: 218 aa, 23 kDa Observed Molecular Weight: 23 kDa GenBank Accession Number: BC016318 Gene Symbol: RRAS Gene ID (NCBI): 6237 RRID: AB_2882282 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P10301 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.