Proteintech, 66962-1-Ig, PAPPA Monoclonal antibody

Size: 20ul / 150ul The PAPPA (66962-1-Ig) by Proteintech is a Monoclonal antibody targeting PAPPA in WB, IHC, ELISA applications with reactivity to human samples 66962-1-Ig targets PAPPA in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human placenta tissue, MCF-7 cells Positive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:4000-1:10000 Immunohistochemistry (IHC): IHC : 1:500-1:1000 Background Information Pregnancy-associated plasma protein A (PAPPA) is a metalloproteinase secreted by human placenta, and it can interact with IGF-binding proteins (IGFBPs) to regulate the proteolysis and the bioavailability of insulin-like growth factor (IGF). Circulating PAPPA represents a consolidated biomarker in combined first-trimester screening tests, allowing an early prenatal diagnosis of chromosomal abnormalities, preeclampsia, and intrauterine growth restriction risk. PAPPA is highly expressed in placenta and pregnancy serum (PMID: 34974815, 34974815). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag11863 Product name: Recombinant human PAPPA protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1279-1627 aa of BC078657 Sequence: ACEPVDCSIPDHHQVYAASFSCPEGTTFGSQCSFQCRHPAQLKGNNSLLTCMEDGLWSFPEALCELMCLAPPPVPNADLQTARCRENKHKVGSFCKYKCKPGYHVPGSSRKSKKRAFKTQCTQDGSWQEGACVPVTCDPPPPKFHGLYQCTNGFQFNSECRIKCEDSDASQGLGSNVIHCRKDGTWNGSFHVCQEMQGQCSVPNELNSNLKLQCPDGYAIGSECATSCLDHNSESIILPMNVTVRDIPHWLNPTRVERVVCTAGLKWYPHPALIHCVKGCEPFMGDNYCDAINNRAFCNYDGGDCCTSTVKTKKVTPFPMSCDLQGDCACRDPQAQEHSRKDLQGYSHG Predict reactive species Full Name: pregnancy-associated plasma protein A, pappalysin 1 Calculated Molecular Weight: 1627 aa, 181 kDa Observed Molecular Weight: 180-220 kDa GenBank Accession Number: BC078657 Gene Symbol: PAPPA Gene ID (NCBI): 5069 RRID: AB_2882285 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q13219 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.