Proteintech, 66966-1-Ig, IKZF1 Monoclonal antibody

Size: 20ul / 150ul The IKZF1 (66966-1-Ig) by Proteintech is a Monoclonal antibody targeting IKZF1 in WB, FC (Intra), ELISA applications with reactivity to human, mouse, pig, rabbit samples 66966-1-Ig targets IKZF1 in WB, IF, FC (Intra), CoIP, ELISA applications and shows reactivity with human, mouse, pig, rabbit samples. Tested Applications Positive WB detected in: Raji cells, Jurkat cells, MOLT-4 cells, pig thymus tissue, rabbit spleen tissue, Ramos cells, Daudi cells, Sp2/0 cells Positive FC (Intra) detected in: Jurkat cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.4 ug per 10^6 cells in a 100 µl suspension Background Information IKZF1, also known as DNA-binding protein Ikaros, Belongs to the Ikaros C2H2-type zinc-finger protein family. The N-terminal zinc-fingers 2 and 3 are required for DNA binding as well as for targeting IKFZ1 to pericentromeric heterochromatin. The C-terminal zinc-finger domain is required for dimerization. IKZF is abundantly expressed in thymus, spleen and peripheral blood Leukocytes and lymph nodes. IKZF1 is localized in nucleus. IKZF1 as a transcription regulator of hematopoietic cell differentiation binds gamma-satellite DNA and plays a role in the development of lymphocytes, B- and T-cells. Binds and activates the enhancer (delta-A element) of the CD3-delta gene. IKZF1 is a repressor of the TDT (fikzfterminal deoxynucleotidyltransferase) gene during thymocyte differentiation. IKZF1 exists some isofroms with MV 58KDa, 48KDa, 48KDa, 43KDa, 41KDa, 32KDa and 53KDa, respectively. Specification Tested Reactivity: human, mouse, pig, rabbit Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag28637 Product name: Recombinant human IKZF1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-303 aa of BC018349 Sequence: MDADEGQDMSQVSGKESPPVSDTPDEGDEPMPIPEDLSTTSGGQQSSKSDRVVASNVKVETQSDEENGRACEMNGEECAEDLRMLDASGEKMNGSHRDQGSSALSGVGGIRLPNGKLKCDICGIICIGPNVLMVHKRSHTGERPFQCNQCGASFTQKGNLLRHIKLHSGEKPFKCHLCNYACRRRDALTGHLRTHSVIKEETNHSEMAEDLCKIGSERSLVLDRLASNVAKRKSSMPQKFLGDKGLSDTPYDSSASYEKENEMMKSHVMDQAINNAINYLGAESLRPLVQTPPGGSEVVPVIS Predict reactive species Full Name: IKAROS family zinc finger 1 (Ikaros) Calculated Molecular Weight: 477 aa, 53 kDa Observed Molecular Weight: 55-65 kDa GenBank Accession Number: BC018349 Gene Symbol: IKZF1 Gene ID (NCBI): 10320 RRID: AB_2882289 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q13422 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.