Iright
BRAND / VENDOR: Proteintech

Proteintech, 66967-2-Ig, GPR116 Monoclonal antibody

CATALOG NUMBER: 66967-2-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The GPR116 (66967-2-Ig) by Proteintech is a Monoclonal antibody targeting GPR116 in WB, ELISA applications with reactivity to human samples 66967-2-Ig targets GPR116 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HUVEC cells, MDA-MB-231 cells, Calu-1 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information GPR116 (ADGRF5, adhesion G protein-coupled receptor F5) is involved in the G protein-coupled receptor signaling pathway and cell surface receptor signaling pathway. may act upstream of or within several processes, including glomerular filtration; pharyngeal arch artery morphogenesis; and surfactant homeostasis. Specification Tested Reactivity: human Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag5820 Product name: Recombinant human GPR116 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 34-349 aa of BC066121 Sequence: LSLHEHEPAGEEALRQKRAVATKSPTAEEYTVNIEISFENASFLDPIKAYLNSLSFPIHGNNTDQITDILSINVTTVCRPAGNEIWCSCETGYGWPRERCLHNLICQERDVFLPGHHCSCLKELPPNGPFCLLQEDVTLNMRVRLNVGFQEDLMNTSSALYRSYKTDLETAFRKGYGILPGFKGVTVTGFKSGSVVVTYEVKTTPPSLELIHKANEQVVQSLNQTYKMDYNSFQAVTINESNFFVTPEIIFEGDTVSLVCEKEVLSSNVSWRYEEQQLEIQNSSRFSIYTALFNNMTSVSKLTIHNITPGDAGEYV Predict reactive species Full Name: G protein-coupled receptor 116 Calculated Molecular Weight: 1346 aa, 149 kDa Observed Molecular Weight: 150 kDa GenBank Accession Number: BC066121 Gene Symbol: GPR116 Gene ID (NCBI): 221395 RRID: AB_3670377 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q8IZF2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924