Iright
BRAND / VENDOR: Proteintech

Proteintech, 66980-1-Ig, NBN / NBS1 Monoclonal antibody

CATALOG NUMBER: 66980-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The NBN / NBS1 (66980-1-Ig) by Proteintech is a Monoclonal antibody targeting NBN / NBS1 in WB, IF/ICC, ELISA applications with reactivity to Human samples 66980-1-Ig targets NBN / NBS1 in WB, IF/ICC, ChIP, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: SKOV-3 cells, LNCaP cells Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information NBN, also named as NBS, NBS1 and P95, is a component of the MRE11/RAD50/NBN (MRN complex) which plays a critical role in the cellular response to DNA damage and the maintenance of chromosome integrity. The complex is involved in double-strand break (DSB) repair, DNA recombination, maintenance of telomere integrity, cell cycle checkpoint control and meiosis. The complex possesses single-strand endonuclease activity and double-strand-specific 3'-5' exonuclease activity, which are provided by MRE11A. NBN modulate the DNA damage signal sensing by recruiting PI3/PI4-kinase family members ATM, ATR, and probably DNA-PKcs to the DNA damage sites and activating their functions. NBN also functions in telomere length maintenance by generating the 3' overhang which serves as a primer for telomerase dependent telomere elongation. NBN is a major player in the control of intra-S-phase checkpoint and there is some evidence that NBN is involved in G1 and G2 checkpoints. Defects in NBN are the cause of Nijmegen breakage syndrome (NBS). Defects in NBN are a cause of genetic susceptibility to breast cancer (BC). Defects in NBN may be associated with aplastic anemia. Defects in NBN might play a role in the pathogenesis of childhood acute lymphoblastic leukemia (ALL). The antibody is specific to NBN. The full-length NBN protein, with an apparent molecular weight of 95 kDa and the two protein fragments of 26 and 70 kDa arising from the c.657_661del5 (p.K219fsX19) mutation, and the 80 kDa protein found in patient RR with the mutation c.742_743insGG leading to excision of exons 6 and 7 from the NBN mRNA are shown. (PMID: 26265251) The predicted molecular weight of NBN protein (p95) is 85kDa, actually detection result is about 95kDa(PMID: 23762398). Specification Tested Reactivity: Human Cited Reactivity: human Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag19320 Product name: Recombinant human NBN protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-350 aa of BC136803 Sequence: MWKLLPAAGPAGGEPYRLLTGVEYVVGRKNCAILIENDQSISRNHAVLTANFSVTNLSQTDEIPVLTLKDNSKYGTFVNEEKMQNGFSRTLKSGDGITFGVFGSKFRIEYEPLVACSSCLDVSGKTALNQAILQLGGFTVNNWTEECTHLVMVSVKVTIKTICALICGRPIVKPEYFTEFLKAVESKKQPPQIESFYPPLDEPSIGSKNVDLSGRQERKQIFKGKTFIFLNAKQHKKLSSAVVFGGGEARLITEENEEEHNFFLAPGTCVVDTGITNSQTLIPDCQKKWIQSIMDMLQRQGLRPIPEAEIGLAVIFMTTKNYCDPQGHPSTGLKTTTPGPSLSQGVSVDE Predict reactive species Full Name: nibrin Calculated Molecular Weight: 85 kDa Observed Molecular Weight: 95 kDa GenBank Accession Number: BC136803 Gene Symbol: NBN Gene ID (NCBI): 4683 RRID: AB_2882300 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O60934 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924