Proteintech, 66994-1-Ig, COPE Monoclonal antibody

Size: 20ul / 150ul The COPE (66994-1-Ig) by Proteintech is a Monoclonal antibody targeting COPE in WB, IF/ICC, ELISA applications with reactivity to Human samples 66994-1-Ig targets COPE in WB, IF/ICC, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, MCF-7 cells, HepG2 cells, LNCaP cells Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: Human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag28602 Product name: Recombinant human COPE protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-308 aa of BC017285 Sequence: MAPPAPGPASGGSGEVDELFDVKNAFYIGSYQQCINEAQRVKLSSPERDVERDVFLYRAYLAQRKFGVVLDEIKPSSAPELQAVRMFADYLAHESRRDSIVAELDREMSRSVDVTNTTFLLMAASIYLHDQNPDAALRALHQGDSLECTAMTVQILLKLDRLDLARKELKRMQDLDEDATLTQLATAWVSLATGGEKLQDAYYIFQEMADKCSPTLLLLNGQAACHMAQGRWEAAEGLLQEALDKDSGYPETLVNLIVLSQHLGKPPEVTNRYLSQLKDAHRSHPFIKEYQAKENDFDRLVLQYAPSA Predict reactive species Full Name: coatomer protein complex, subunit epsilon Calculated Molecular Weight: 34 kDa Observed Molecular Weight: 32 kDa GenBank Accession Number: BC017285 Gene Symbol: COPE Gene ID (NCBI): 11316 RRID: AB_2882311 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: O14579 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.