Proteintech, 66997-1-Ig, Neuroserpin Monoclonal antibody

Size: 20ul / 150ul The Neuroserpin (66997-1-Ig) by Proteintech is a Monoclonal antibody targeting Neuroserpin in WB, IHC, IF/ICC, ELISA applications with reactivity to human, rat, pig samples 66997-1-Ig targets Neuroserpin in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, rat, pig samples. Tested Applications Positive WB detected in: pig brain tissue Positive IHC detected in: rat cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U-251 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:150-1:600 Immunofluorescence (IF)/ICC: IF/ICC : 1:1000-1:4000 Background Information Neuroserpin is a member of the serpin family of serine protease inhibitors predominantly expressed in the nervous system, such as s the cerebral cortex, hippocampus and the spinal cord.Neuroserpin exerts protective effects in neurons against excitotoxicity both in vitro and in vivo. Its proteolytic inhibitory activity is shown to protect neurons against damage caused by plasmin activation. Mice overexpressing neuroserpin exhibited loss of tPA activity in the brain. Overexpression of neuroserpin in primary neurons leads to increased dendritic arborization and altered dendritic spine shape. Specification Tested Reactivity: human, rat, pig Cited Reactivity: mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag28636 Product name: Recombinant human SERPINI1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 109-410 aa of BC018043 Sequence: ANSLFVQNGFHVNEEFLQMMKKYFNAAVNHVDFSQNVAVANYINKWVENNTNNLVKDLVSPRDFDAATYLALINAVYFKGNWKSQFRPENTRTFSFTKDDESEVQIPMMYQQGEFYYGEFSDGSNEAGGIYQVLEIPYEGDEISMMLVLSRQEVPLATLEPLVKAQLVEEWANSVKKQKVEVYLPRFTVEQEIDLKDVLKALGITEIFIKDANLTGLYDNKEIFLSKAIHKSFLEVNEEGSEAAAVSGMIAISRMAVLYPQVIVDHPFFFLIRNRRTGTILFMGRVMHPETMNTSGHDFEEL Predict reactive species Full Name: serpin peptidase inhibitor, clade I (neuroserpin), member 1 Calculated Molecular Weight: 410 aa, 47 kDa Observed Molecular Weight: 46 kDa GenBank Accession Number: BC018043 Gene Symbol: Neuroserpin Gene ID (NCBI): 5274 RRID: AB_2882314 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q99574 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.