Proteintech, 67003-1-Ig, ICOSLG/B7-H2/CD275 Monoclonal antibody

Size: 20ul / 150ul The ICOSLG/B7-H2/CD275 (67003-1-Ig) by Proteintech is a Monoclonal antibody targeting ICOSLG/B7-H2/CD275 in WB, ELISA applications with reactivity to Human samples 67003-1-Ig targets ICOSLG/B7-H2/CD275 in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: HL-60 cells, Daudi cells, HUVEC cells, JAR cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information ICOSLG, also known as B7H2 or GL50, is a type I transmembrane glycoprotein belonging to the B7 ligand family. ICOSLG is extensively expressed on professional antigen-presenting cells including B cells, macrophages, and dendritic cells, as well as non-lymphoid cells including mesenchymal stem cells, endothelial cells, fibroblasts, and tumor cells (PMID: 33756276; 35800767). It is a specific ligand for the T-cell-specific cell surface receptor ICOS and acts as a co-stimulatory molecule (PMID: 11023515; 11007762). The interaction of ICOSLG and ICOS plays important roles in the activation, proliferation, differentiation, and cytokine production of T cells as well as in the antibody secretion from B cells during secondary immune responses (PMID: 21851236). Specification Tested Reactivity: Human Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag6799 Product name: Recombinant human ICOSLG protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-302 aa of BC064637 Sequence: MRLGSPGLLFLLFSSLRADTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSILAVLCLLVVVAVAIGWVCRDRCLQHSYAGAWAVSPETELTGHV Predict reactive species Full Name: inducible T-cell co-stimulator ligand Calculated Molecular Weight: 33 kDa, 34 kDa Observed Molecular Weight: 60-65 kDa, 28-35 kDa GenBank Accession Number: BC064637 Gene Symbol: ICOSLG Gene ID (NCBI): 23308 RRID: AB_2882320 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O75144 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.