Iright
BRAND / VENDOR: Proteintech

Proteintech, 67004-1-Ig, TGM1 Monoclonal antibody

CATALOG NUMBER: 67004-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TGM1 (67004-1-Ig) by Proteintech is a Monoclonal antibody targeting TGM1 in WB, IHC, ELISA applications with reactivity to human samples 67004-1-Ig targets TGM1 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human saliva tissue Positive IHC detected in: human tonsillitis tissue, human cervical cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information Transglutaminase 1 is a epidermal enzyme that is expressed during the terminal differentiation of keratinized squamous epithelium to form cornified cell envelope in differentiated keratinocytes. Mutation of TGM1 has been linked to various epidermal diseases. This antibody recognizes the endogenous 90 kDa TGM1 proteins. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag3905 Product name: Recombinant human TGM1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 467-817 aa of BC034699 Sequence: SGIFCCGPCSVESIKNGLVYMKYDTPFIFAEVNSDKVYWQRQDDGSFKIVYVEEKAIGTLIVTKAISSNMREDITYLYKHPEGSDAERKAVETAAAHGSKPNVYANRGSAEDVAMQVEAQDAVMGQDLMVSVMLINHSSSRRTVKLHLYLSVTFYTGVSGTIFKETKKEVELAPGASDRVTMPVAYKEYRPHLVDQGAMLLNVSGHVKESGQVLAKQHTFRLRTPDLSLTLLGAAVVGQECEVQIVFKNPLPVTLTNVVFRLEGSGLQRPKILNVGDIGGNETVTLRQSFVPVRPGPRQLIASLDSPQLSQVHGVIQVDVAPAPGDGGFFSDAGGDSHLGETIPMASRGGA Predict reactive species Full Name: transglutaminase 1 (K polypeptide epidermal type I, protein-glutamine-gamma-glutamyltransferase) Calculated Molecular Weight: 817 aa, 90 kDa Observed Molecular Weight: 90 kDa GenBank Accession Number: BC034699 Gene Symbol: TGM1 Gene ID (NCBI): 7051 RRID: AB_2882321 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P22735 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924