Iright
BRAND / VENDOR: Proteintech

Proteintech, 67011-1-Ig, PLCG2 Monoclonal antibody

CATALOG NUMBER: 67011-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PLCG2 (67011-1-Ig) by Proteintech is a Monoclonal antibody targeting PLCG2 in WB, IHC, ELISA applications with reactivity to human samples 67011-1-Ig targets PLCG2 in WB, IHC, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Ramos cells, Raji cells, Karpas-422 cells, rabbit spleen tissue, Daudi cells Positive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Phospholipase C-gamma2 (PLCG2) is a transmembrane signaling enzyme that catalyzes the conversion of 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate to 1D-myo-inositol 1,4,5-trisphosphate (IP3) and diacylglycerol (DAG) using calcium as a cofactor.IP3 and DAG are second messenger molecules important for transmitting signals from growth factor receptors and immune system receptors across the cell membrane. Mutations in this gene have been found in autoinflammation, antibody deficiency, and immune dysregulation syndrome and familial cold autoinflammatory syndrome 3. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag24355 Product name: Recombinant human PLCG2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 150-313 aa of BC007565 Sequence: IYSVDQTRRNSISLRELKTILPLINFKVSSAKFLKDKFVEIGAHKDELSFEQFHLFYKKLMFEQQKSILDEFKKDSSVFILGNTDRPDASAVYLRDFQRFLIHEQQEHWAQDLNKVRERMTKFIDDTMRETAEPFLFVDEFLTYLFSRENSIWDEKYDAVDMQD Predict reactive species Full Name: phospholipase C, gamma 2 (phosphatidylinositol-specific) Calculated Molecular Weight: 148 kDa Observed Molecular Weight: 148 kDa GenBank Accession Number: BC007565 Gene Symbol: PLCG2 Gene ID (NCBI): 5336 RRID: AB_2882328 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P16885 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924