Iright
BRAND / VENDOR: Proteintech

Proteintech, 67015-1-Ig, MAP2 Monoclonal antibody

CATALOG NUMBER: 67015-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MAP2 (67015-1-Ig) by Proteintech is a Monoclonal antibody targeting MAP2 in IHC, IF-P, IF-Fro, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples 67015-1-Ig targets MAP2 in WB, IHC, IF-P, IF-Fro, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IHC detected in: mouse brain tissue, rat cerebellum tissue, rat brain tissue, human brain tissue, mouse cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: rat brain tissue, mouse brain tissue Positive IF-Fro detected in: rat brain tissue, mouse brain tissue Positive FC (Intra) detected in: Neuro-2a cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Immunofluorescence (IF)-FRO: IF-FRO : 1:1000-1:4000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information MAP2 (microtubule-associated protein 2) is a cytoskeleton protein abundant in brain and has important role in neuronal morphogenesis. Multiple high molecular weight (MW) and low molecular weight (MW) MAP2 isoforms are expressed within axons, dendrites, and cell bodies. The expression of MAP2 is regulated in both a tissue- and developmentally specific manner. MAP2 antibodies have been widely used to mark the neuron or dendrite formation. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, monkey Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag11349 Product name: Recombinant human MAP2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 213-559 aa of BC038857 Sequence: TSAGSTDRLPYSKSGNKDGVTKSPEKRSSLPRPSSILPPRRGVSGDRDENSFSLNSSISSSARRTTRSEPIRRAGKSGTSTPTTPGSTAITPGTPPSYSSRTPGTPGTPSYPRTPHTPGTPKSAILVPSEKKVAIIRTPPKSPATPKQLRLINQPLPDLKNVKSKIGSTDNIKYQPKGGQVRILNKKIDFSKVQSRCGSKDNIKHSAGGGNVQIVTKKIDLSHVTSKCGSLKNIRHRPGGGRVKIESVKLDFKEKAQAKVGSLDNAHHVPGGGNVKIDSQKLNFREHAKARVDHGAEIITQSPGRSSVASPRRLSNVSSSGSINLLESPQLATLAEDVTAALAKQGL Predict reactive species Full Name: microtubule-associated protein 2 Calculated Molecular Weight: 200 kDa GenBank Accession Number: BC038857 Gene Symbol: MAP2 Gene ID (NCBI): 4133 RRID: AB_2882331 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P11137 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924