Iright
BRAND / VENDOR: Proteintech

Proteintech, 67032-1-Ig, NEU1 Monoclonal antibody

CATALOG NUMBER: 67032-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The NEU1 (67032-1-Ig) by Proteintech is a Monoclonal antibody targeting NEU1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat, pig samples 67032-1-Ig targets NEU1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: PC-12 cells, pig liver tissue, rat liver tissue, rat pancreas tissue, mouse liver tissue Positive IHC detected in: human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U-251 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:150-1:600 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information NEU1 (lysosomal sialidase) encodes a kind of lysosomal enzyme that could cleave terminal sialic acids from glycoproteins or glycolipids to regulate various biological processes by conformational change (PMID:28130415). In the lysosome, NEU1 is one member of a heterotrimeric complex, the others are beta-galactosidase and cathepsin A. The NEU1 is widely expressed in mammalian tissues and involved in lysosomal storage disorder sialidosis, autoimmune diseases and the malignancy and metastasis of cancer cells (PMID:19075514). NUE1 also expresses on the plasma membrane where it modulates several signalling molecules about inflammation, exocytosis, phagocytosis, cell adhesion and proliferation (PMID:21928149). Additionally, it is reported that mutations in human NEU1 could lead to sialidosis (PMID:14517945). Specification Tested Reactivity: human, mouse, rat, pig Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag27945 Product name: Recombinant human NEU1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 96-415 aa of BC011900 Sequence: ARKMSSSDEGAKFIALRRSMDQGSTWSPTAFIVNDGDVPDGLNLGAVVSDVETGVVFLFYSLCAHKAGCQVASTMLVWSKDDGVSWSTPRNLSLDIGTEVFAPGPGSGIQKQREPRKGRLIVCGHGTLERDGVFCLLSDDHGASWRYGSGVSGIPYGQPKQENDFNPDECQPYELPDGSVVINARNQNNYHCHCRIVLRSYDACDTLRPRDVTFDPELVDPVVAAGAVVTSSGIVFFSNPAHPEFRVNLTLRWSFSNGTSWRKETVQLWPGPSGYSSLATLEGSMDGEEQAPQLYVLYEKGRNHYTESISVAKISVYGTL Predict reactive species Full Name: sialidase 1 (lysosomal sialidase) Calculated Molecular Weight: 45 kDa Observed Molecular Weight: 45-48 kDa GenBank Accession Number: BC011900 Gene Symbol: NEU1 Gene ID (NCBI): 4758 RRID: AB_2882347 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q99519 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924