Iright
BRAND / VENDOR: Proteintech

Proteintech, 67035-1-Ig, CRK Monoclonal antibody

CATALOG NUMBER: 67035-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CRK (67035-1-Ig) by Proteintech is a Monoclonal antibody targeting CRK in WB, ELISA applications with reactivity to human, mouse, rat samples 67035-1-Ig targets CRK in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, HSC-T6 cells, Jurkat cells, NIH/3T3 cells, RAW 264.7 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information CRK is a member of an adapter protein family that binds to several tyrosine-phosphorylated proteins. CRK has several SH2 and SH3 domains (src-homology domains) and is involved in several signaling pathways, recruiting cytoplasmic proteins in the vicinity of tyrosine kinase through SH2-phosphotyrosine interaction. The N-terminal SH2 domain of this protein functions as a positive regulator of transformation whereas the C-terminal SH3 domain functions as a negative regulator of transformation. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag28793 Product name: Recombinant human CRK protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 41-304 aa of BC008506 Sequence: STSPGDYVLSVSENSRVSHYIINSSGPRPPVPPSPAQPPPGVSPSRLRIGDQEFDSLPALLEFYKIHYLDTTTLIEPVSRSRQGSGVILRQEEAEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIPVPYVEKYRPASASVSALIGGNQEGSHPQPLGGPEPGPYAQPSVNTPLPNLQNGPIYARVIQKRVPNAYDKTALALEVGELVKVTKINVSGQWEGECNGKRGHFPFTHVRLLDQQNPDEDFS Predict reactive species Full Name: v-crk sarcoma virus CT10 oncogene homolog (avian) Calculated Molecular Weight: 34 kDa Observed Molecular Weight: 34 kDa GenBank Accession Number: BC008506 Gene Symbol: CRK Gene ID (NCBI): 1398 RRID: AB_2882350 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P46108 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924