Iright
BRAND / VENDOR: Proteintech

Proteintech, 67041-1-Ig, DNASE1L3 Monoclonal antibody

CATALOG NUMBER: 67041-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The DNASE1L3 (67041-1-Ig) by Proteintech is a Monoclonal antibody targeting DNASE1L3 in WB, IHC, ELISA applications with reactivity to human, mouse samples 67041-1-Ig targets DNASE1L3 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293 cells, U2OS cells, Daudi cells, A431 cells, LnCaP cells, Jurkat cells, K-562 cells, HepG2 cells, Raji cells Positive IHC detected in: mouse liver tissue, human spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Deoxyribonuclease 1-like 3 (DNASE1L3, DNase gamma, DNase Y, LS-DNase) is member of a DNASE1 protein family that is identified by similar biochemical properties such as Ca2+/Mg2+- dependency and an optimal pH of about 7.0 as well as by a high similarity in their nucleic acid and amino acid sequences (PMID:157967140). It is an endonuclease and cleaves double-stranded DNA (and single-stranded DNA) producing 3′-OH/5′-P ends, which is Ca2+/Mg2+-dependent and inhibited by Zn2+, but not by monomeric actin (PMID:9665719). In addition, it translocates from the endoplasmic reticulum to the nucleus during apoptosis (PMID: 23229555). DNASE1L3 can be located either in the cytoplasm or in the nucleus. Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag28187 Product name: Recombinant human DNASE1L3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-305 aa of BC015831 Sequence: MSRELAPLLLLLLSIHSALAMRICSFNVRSFGESKQEDKNAMDVIVKVIKRCDIILVMEIKDSNNRICPILMEKLNRNSRRGITYNYVISSRLGRNTYKEQYAFLYKEKLVSVKRSYHYHDYQDGDADVFSREPFVVWFQSPHTAVKDFVIIPLHTTPETSVKEIDELVEVYTDVKHRWKAENFIFMGDFNAGCSYVPKKAWKNIRLRTDPRFVWLIGDQEDTTVKKSTNCAYDRIVLRGQEIVSSVVPKSNSVFDFQKAYKLTEEEALDVSDHFPVEFKLQSSRAFTNSKKSVTLRKKTKSKRS Predict reactive species Full Name: deoxyribonuclease I-like 3 Calculated Molecular Weight: 305 aa, 36 kDa Observed Molecular Weight: 33-38 kDa GenBank Accession Number: BC015831 Gene Symbol: DNASE1L3 Gene ID (NCBI): 1776 RRID: AB_2882355 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q13609 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924