Proteintech, 67043-1-Ig, COMMD5 Monoclonal antibody

Size: 20ul / 150ul The COMMD5 (67043-1-Ig) by Proteintech is a Monoclonal antibody targeting COMMD5 in WB, ELISA applications with reactivity to Human, Rat samples 67043-1-Ig targets COMMD5 in WB, ELISA applications and shows reactivity with Human, Rat samples. Tested Applications Positive WB detected in: human heart tissue, rat heart tissue, MCF-7 cells, HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:6000 Background Information COMM domain containing 5 (COMMD5, synonyms: HCARG, HT002) is a hypertension-related calcium-regulated gene. COMMD5 is negatively regulated by extracellular calcium concentration, and its basal mRNA levels were higher in hypertensive animals. Tissue distribution of COMMD5 shows a preponderance in the heart, stomach, jejunum, kidney (tubular fraction), liver, and adrenal gland (mainly in the medulla). COMMD5 mRNA is significantly more expressed in adult than in fetal organs, and its levels are decreased in tumors and cancerous cell lines. COMMD5 protein has no transmembrane domain, but contains 67% -helix content, a calcium-binding site, four putative "leucine zipper" motifs, and a nuclear receptor-binding domain. At the subcellular level, COMMD5 shows a nuclear localization. Specification Tested Reactivity: Human, Rat Cited Reactivity: human Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag18464 Product name: Recombinant human COMMD5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 4-159 aa of BC003055 Sequence: VGAATPYLHHPGDSHSGRVSFLGAQLPPEVAAMARLLGDLDRSTFRKLLKFVVSSLQGEDCREAVQRLGVSANLPEEQLGALLAGMHTLLQQALRLPPTSLKPDTFRDQLQELCIPQDLVGDLASVVFGSQRPLLDSVAQQQGAWLPHVADFRWRV Predict reactive species Full Name: COMM domain containing 5 Calculated Molecular Weight: 25 kDa Observed Molecular Weight: 15 kDa GenBank Accession Number: BC003055 Gene Symbol: COMMD5 Gene ID (NCBI): 28991 RRID: AB_2882357 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9GZQ3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.