Proteintech, 67047-1-Ig, GUK1 Monoclonal antibody

Size: 20ul / 150ul The GUK1 (67047-1-Ig) by Proteintech is a Monoclonal antibody targeting GUK1 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 67047-1-Ig targets GUK1 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Jurkat cells, HEK-293 cells, fetal human brain tissue, rat brain tissue, mouse brain tissue, HeLa cells Positive IHC detected in: human thyroid cancer tissue, human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human thyroid cancer tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Immunohistochemistry (IHC): IHC : 1:400-1:1600 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag28805 Product name: Recombinant human GUK1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-197 aa of BC009914 Sequence: MSGPRPVVLSGPSGAGKSTLLKRLLQEHSGIFGFSVSHTTRNPRPGEENGKDYYFVTREVMQRDIAAGDFIEHAEFSGNLYGTSKVAVQAVQAMNRICVLDVDLQGVRNIKATDLRPIYISVQPPSLHVLEQRLRQRNTETEESLVKRLAAAQADMESSKEPGLFDVVIINDSLDQAYAELKEALSEEIKKAQRTGA Predict reactive species Full Name: guanylate kinase 1 Calculated Molecular Weight: 22 kDa Observed Molecular Weight: 22-27 kDa GenBank Accession Number: BC009914 Gene Symbol: GUK1 Gene ID (NCBI): 2987 RRID: AB_2882360 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q16774 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.