Iright
BRAND / VENDOR: Proteintech

Proteintech, 67052-1-Ig, SMAD5 Monoclonal antibody

CATALOG NUMBER: 67052-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SMAD5 (67052-1-Ig) by Proteintech is a Monoclonal antibody targeting SMAD5 in WB, IHC, ELISA applications with reactivity to Human, mouse, rat samples 67052-1-Ig targets SMAD5 in WB, IHC, CoIP, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, MCF-7 cells, HT-29 cells, Caco-2 cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells Positive IHC detected in: human breast cancer tissue, human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:150-1:600 Background Information SMAD5, also named as MADH5 and JV5-1, is a transcriptional modulator activated by BMP (bone morphogenetic proteins) type 1 receptor kinase. SMAD5 is a receptor-regulated SMAD (R-SMAD). It plays a critical role in the signaling pathway by which TGF-beta inhibits the proliferation of human hematopoietic progenitor cells. Specification Tested Reactivity: Human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag28699 Product name: Recombinant human SMAD5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 161-465 aa of BC009682 Sequence: SHNEPHMPQNATFPDSFHQPNNTPFPLSPNSPYPPSPASSTYPNSPASSGPGSPFQLPADTPPPAYMPPDDQMGQDNSQPMDTSNNMIPQIMPSISSRDVQPVAYEEPKHWCSIVYYELNNRVGEAFHASSTSVLVDGFTDPSNNKSRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECLSDSSIFVQSRNCNFHHGFHPTTVCKIPSSCSLKIFNNQEFAQLLAQSVNHGFEAVYELTKMCTIRMSFVKGWGAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPLNPISSVS Predict reactive species Full Name: SMAD family member 5 Calculated Molecular Weight: 465 aa, 52 kDa Observed Molecular Weight: 52 kDa GenBank Accession Number: BC009682 Gene Symbol: SMAD5 Gene ID (NCBI): 4090 RRID: AB_2882365 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q99717 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924