Proteintech, 67055-1-Ig, ERCC5 Monoclonal antibody

Size: 20ul / 150ul The ERCC5 (67055-1-Ig) by Proteintech is a Monoclonal antibody targeting ERCC5 in WB, ELISA applications with reactivity to human samples 67055-1-Ig targets ERCC5 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HT-29 cells, COLO 320 cells, Daudi cells, Ramos cells, HeLa cells, HepG2 cells, Jurkat cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information The human genes correcting DNA repair defects are termed excision-repair cross-complementing or ERCC genes. The ERCC5 gene corrects the excision repair deficiency of Chinese hamster ovary cell line UV135 of complementation group 5. The human ERCC5 gene product is a structure-specific endonuclease required for making the 3-prime incision during DNA nucleotide excision-repair (NER). It also plays an important role in regulating DNA excision repair, removal of bulky lesions caused by environmental chemicals or UV light [PMID:22815677]. The calculated molecular weight of ERCC5 is 133 kDa, but the modified ERCC5 protein is about 200 kDa. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag28561 Product name: Recombinant human ERCC5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 880-1186 aa of BC031522 Sequence: EFPGHGLEPLLKFSEWWHEAQKNPKIRPNPHDTKVKKKLRTLQLTPGFPNPAVAEAYLKPVVDDSKGSFLWGKPDLDKIREFCQRYFGWNRTKTDESLFPVLKQLDAQQTQLRIDSFFRLAQQEKEDAKRIKSQRLNRAVTCMLRKEKEAAASEIEAVSVAMEKEFELLDKAKRKTQKRGITNTLEESSSLKRKRLSDSKRKNTCGGFLGETCLSESSDGSSSEDAESSSLMNVQRRTAAKEPKTSASDSQNSVKEAPVKNGGATTSSSSDSDDDGGKEKMVLVTARSVFGKKRRKLRRARGRKRKT Predict reactive species Full Name: excision repair cross-complementing rodent repair deficiency, complementation group 5 Calculated Molecular Weight: 1186 aa, 133 kDa Observed Molecular Weight: 200 kDa GenBank Accession Number: BC031522 Gene Symbol: ERCC5 Gene ID (NCBI): 2073 RRID: AB_2882366 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P28715 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.