Iright
BRAND / VENDOR: Proteintech

Proteintech, 67060-1-Ig, INTS3 Monoclonal antibody

CATALOG NUMBER: 67060-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The INTS3 (67060-1-Ig) by Proteintech is a Monoclonal antibody targeting INTS3 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 67060-1-Ig targets INTS3 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, 4T1 cells, MCF-7 cells, HepG2 cells, Jurkat cells, HSC-T6 cells, PC-12 cells, NIH/3T3 cells, HeLa cells Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag9917 Product name: Recombinant human INTS3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 91-445 aa of BC025254 Sequence: YHLLYYLRASKAAAGKMNLYESFAQATQLGDLHTCLMMDMKACQEDDVRLLCHLTPSIYTEFPDETLRSGELLNMIVAVIDSAQLQELVCHVMMGNLVMFRKDSVLNILIQSLDWETFEQYCAWQLFLAHNIPLETIIPILQHLKYKEHPEALSCLLLQLRREKPSEEMVKMVLSRPCHPDDQFTTSILRHWCMKHDELLAEHIKSLLIKNNSLPRKRQSLRSSSSKLAQLTLEQILEHLDNLRLNLTNTKQNFFSQTPILQALQHVQASCDEAHKMKFSDLFSLAEEYEDSSTKPPKSRRKAALSSPRSRKNATQPPNAEEESGSSSASEEEDTKPKPTKRKRKGSSAVGSDSD Predict reactive species Full Name: integrator complex subunit 3 Calculated Molecular Weight: 118 kDa Observed Molecular Weight: 118 kDa GenBank Accession Number: BC025254 Gene Symbol: INTS3 Gene ID (NCBI): 65123 RRID: AB_2882370 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q68E01 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924