Proteintech, 67063-1-Ig, C1QA Monoclonal antibody

Size: 20ul / 150ul The C1QA (67063-1-Ig) by Proteintech is a Monoclonal antibody targeting C1QA in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 67063-1-Ig targets C1QA in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human plasma tissue, human blood tissue Positive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information The first component of complement, C1, is a calcium-dependent complex of the 3 subcomponents C1q, C1r, and C1s. C1q is composed of 18 polypeptide chains: six A-chains, six B-chains, and six C-chains. Each chain contains a collagen-like region located near the N terminus and a C-terminal globular region. Deficiency of C1q has been associated with lupus erythematosus and glomerulonephritis. This antibody is raised against C1qA which is the A-chain polypeptide of human complement subcomponent C1q. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag28622 Product name: Recombinant human C1QA protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-245 aa of BC030153 Sequence: MEGPRGWLVLCVLAISLASMVTEDLCRAPDGKKGEAGRPGRRGRPGLKGEQGEPGAPGIRTGIQGLKGDQGEPGPSGNPGKVGYPGPSGPLGARGIPGIKGTKGSPGNIKDQPRPAFSAIRRNPPMGGNVVIFDTVITNQEEPYQNHSGRFVCTVPGYYYFTFQVLSQWEICLSIVSSSRGQVRRSLGFCDTTNKGLFQVVSGGMVLQLQQGDQVWVEKDPKKGHIYQGSEADSVFSGFLIFPSA Predict reactive species Full Name: complement component 1, q subcomponent, A chain Calculated Molecular Weight: 245 aa, 26 kDa Observed Molecular Weight: 30 kDa GenBank Accession Number: BC030153 Gene Symbol: C1QA Gene ID (NCBI): 712 RRID: AB_2882373 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P02745 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.