Iright
BRAND / VENDOR: Proteintech

Proteintech, 67067-1-Ig, ADRBK1 Monoclonal antibody

CATALOG NUMBER: 67067-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ADRBK1 (67067-1-Ig) by Proteintech is a Monoclonal antibody targeting ADRBK1 in WB, IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 67067-1-Ig targets ADRBK1 in WB, IHC, IF/ICC, FC (Intra), CoIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: THP-1 cells, U-937 cells, HL-60 cells, K-562 cells, Jurkat cells Positive IHC detected in: human lymphoma tissue, human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: Jurkat cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag5071 Product name: Recombinant human ADRBK1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 390-689 aa of BC037963 Sequence: PFRQHKTKDKHEIDRMTLTMAVELPDSFSPELRSLLEGLLQRDVNRRLGCLGRGAQEVKESPFFRSLDWQMVFLQKYPPPLIPPRGEVNAADAFDIGSFDEEDTKGIKLLDSDQELYRNFPLTISERWQQEVAETVFDTINAETDRLEARKKAKNKQLGHEEDYALGKDCIMHGYMSKMGNPFLTQWQRRYFYLFPNRLEWRGEGEAPQSLLTMEEIQSVEETQIKERKCLLLKIRGGKQFILQCDSDPELVQWKKELRDAYREAQQLVQRVPKMKNKPRSPVVELSKVPLVQRGSANGL Predict reactive species Full Name: adrenergic, beta, receptor kinase 1 Calculated Molecular Weight: 689 aa, 80 kDa Observed Molecular Weight: 80 kDa GenBank Accession Number: BC037963 Gene Symbol: ADRBK1 Gene ID (NCBI): 156 RRID: AB_2882377 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P25098 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924