Proteintech, 67078-1-Ig, Alpha Sarcoglycan Monoclonal antibody

Size: 20ul / 150ul The Alpha Sarcoglycan (67078-1-Ig) by Proteintech is a Monoclonal antibody targeting Alpha Sarcoglycan in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat, pig samples 67078-1-Ig targets Alpha Sarcoglycan in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: human skeletal muscle tissue, human heart tissue, pig heart tissue, rat skeletal muscle tissue, pig skeletal muscle tissue, rat heart tissue, mouse skeletal muscle tissue Positive IHC detected in: mouse skeletal muscle tissue, human liver tissue, mouse heart tissue, mouse tongue tissue, rat heart tissue, rat skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse heart tissue, mouse skeletal muscle tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information Alpha-sarcoglycan is a member of the sarcoglycan-sarcospan complex (SG-SSPN), which is constituted by α/ɛ-, β-, γ-, and δ-SGs as well as SSPN. Alpha-sarcoglycan gene expression is exclusive of striated muscle and is finely regulated during myogenic differentiation, where the amount of alpha-sarcoglycan transcript is selectively increased after differentiation to myotubes (MTs). Alpha sarcoglycan's disruption causes limb-girdle muscular dystrophy. Specification Tested Reactivity: human, mouse, rat, pig Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag28800 Product name: Recombinant human SGCA protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 25-289 aa of BC025702 Sequence: QTTLHPLVGRVFVHTLDHETFLSLPEHVAVPPAVHITYHAHLQGHPDLPRWLRYTQRSPHHPGFLYGSATPEDRGLQVIEVTAYNRDSFDTTRQRLVLEIGDPEGPLLPYQAEFLVRSHDAEEVLPSTPASRFLSALGGLWEPGELQLLNVTSALDRGGRVPLPIEGRKEGVYIKVGSASPFSTCLKMVASPDSHARCAQGQPPLLSCYDTLAPHFRVDWCNVTLVDKSVPEPADEVPTPGDGILEHDPFFCPPTEAPDRDFLVD Predict reactive species Full Name: sarcoglycan, alpha (50kDa dystrophin-associated glycoprotein) Calculated Molecular Weight: 387 aa, 43 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC025702 Gene Symbol: alpha Sarcoglycan Gene ID (NCBI): 6442 RRID: AB_2882386 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q16586 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.