Proteintech, 67083-1-Ig, EAAT2 Monoclonal antibody

Size: 20ul / 150ul The EAAT2 (67083-1-Ig) by Proteintech is a Monoclonal antibody targeting EAAT2 in WB, ELISA applications with reactivity to human, mouse, rat samples 67083-1-Ig targets EAAT2 in WB, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: rat brain tissue, rat cerebellum tissue, mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Background Information EAAT2 (also known as GLT-1), is encoded by SLC1A2 and is a glutamate transporter which can clear the majority of extracellular glutamate in brain and prevent brain seizures.Three isoforms of EAAT2 exist due to the alternative splicing. In addition to the 65-70 kDa monomer form, 130-150 kDa dimer of EAAT2 can also be observed on SDS-PAGE.(PMID: 22114258) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag19816 Product name: Recombinant human SLC1A2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 460-574 aa of BC132768 Sequence: PTEDISLLVAVDWLLDRMRTSVNVVGDSFGAGIVYHLSKSELDTIDSQHRVHEDIEMTKTQSIYDDMKNHRESNSNQCVYAAHNSVIVDECKVTLAANGKSADCSVEEEPWKREK Predict reactive species Full Name: solute carrier family 1 (glial high affinity glutamate transporter), member 2 Calculated Molecular Weight: 574 aa, 62 kDa Observed Molecular Weight: 60-70 kDa GenBank Accession Number: BC132768 Gene Symbol: EAAT2 Gene ID (NCBI): 6506 RRID: AB_2882391 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P43004 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.