Proteintech, 67086-1-Ig, RUNX1T1 Monoclonal antibody

Size: 20ul / 150ul The RUNX1T1 (67086-1-Ig) by Proteintech is a Monoclonal antibody targeting RUNX1T1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat, pig samples 67086-1-Ig targets RUNX1T1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: Jurkat cells, HEK-293 cells, pig brain tissue, K-562 cells, rat brain tissue, mouse brain tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information RUNX1T1 is a putative zinc finger transcription factor and oncoprotein. In acute myeloid leukemia, especially in the M2 subtype, the t(8;21)(q22;q22) translocation is one of the most frequent karyotypic abnormalities. The translocation produces a chimeric gene made up of the 5'-region of the RUNX1 gene fused to the 3'-region of this gene. Various transcript of the fusion gene has been reported. RUNX1T1 exists some isoforms with MV 68, 67,64, 48 and 44 kDa. The calcualted molecular weight of RUNX1T1 is 67 kDa, but modified RUNX1T1is about 70-75 kDa. Specification Tested Reactivity: human, mouse, rat, pig Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag7893 Product name: Recombinant human RUNX1T1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-351 aa of BC005850 Sequence: MPDSPVDVKTQSRLTPPTMPPPPTTQGAPRTSSFTPTTLTNGTSHSPTALNGAPSPPNGFSNGPSSSSSSSLANQQLPPACGARQLSKLKRFLTTLQQFGNDISPEIGERVRTLVLGLVNSTLTIEEFHSKLQEATNFPLRPFVIPFLKANLPLLQRELLHCARLAKQNPAQYLAQHEQLLLDASTTSPVDSSELLLDVNENGKRRTPDRTKENGFDREPLHSEHPSKRPCTISPGQRYSPNNGLSYQPNGLPHPTPPPPQHYRLDDMAIAHHYRDSYRHPSHRDLRDRNRPMGLHGTRQEEMIDHRLTDREWAEEWKHLDHLLNCIMDMVEKTRRSLTVLRRCQEADREE Predict reactive species Full Name: runt-related transcription factor 1; translocated to, 1 (cyclin D-related) Calculated Molecular Weight: 68 kDa Observed Molecular Weight: 70-75 kDa GenBank Accession Number: BC005850 Gene Symbol: RUNX1T1 Gene ID (NCBI): 862 RRID: AB_2882394 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q06455 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.