Proteintech, 67089-1-Ig, CNTN2 Monoclonal antibody

Size: 20ul / 150ul The CNTN2 (67089-1-Ig) by Proteintech is a Monoclonal antibody targeting CNTN2 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, pig samples 67089-1-Ig targets CNTN2 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, pig samples. Tested Applications Positive WB detected in: pig brain tissue, pig cerebellum tissue, pig spinal cord tissue Positive IHC detected in: mouse brain tissue, rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Specification Tested Reactivity: human, mouse, pig Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag28301 Product name: Recombinant human CNTN2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 865-943 aa of NM_005076 Sequence: MRTAGLDTSARVSGLHPNTKYHVTVRAYNRAGTGPASPSANATTMKPPPRRPPGNISWTFSSSSLSIKWDPVVPFRNESA Predict reactive species Full Name: contactin 2 (axonal) Calculated Molecular Weight: 113 kDa Observed Molecular Weight: 113-135 kDa GenBank Accession Number: NM_005076 Gene Symbol: CNTN2 Gene ID (NCBI): 6900 RRID: AB_2918481 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q02246 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.