Iright
BRAND / VENDOR: Proteintech

Proteintech, 67093-1-Ig, RALA Monoclonal antibody

CATALOG NUMBER: 67093-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The RALA (67093-1-Ig) by Proteintech is a Monoclonal antibody targeting RALA in WB, IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human, pig samples 67093-1-Ig targets RALA in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, pig samples. Tested Applications Positive WB detected in: HeLa cells, pig brain tissue, MCF-7 cells, HepG2 cells, Jurkat cells, rat brain tissue, mouse brain tissue Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells Positive FC (Intra) detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Specification Tested Reactivity: human, pig Cited Reactivity: human Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag5329 Product name: Recombinant human RALA protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-206 aa of BC039858 Sequence: MAANKPKGQNSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENVPFLLVGNKSDLEDKRQVSVEEAKNRAEQWNVNYVETSAKTRANVDKVFFDLMREIRARKMEDSKEKNGKKKRKSLAKRIRERCCIL Predict reactive species Full Name: v-ral simian leukemia viral oncogene homolog A (ras related) Calculated Molecular Weight: 206 aa, 24 kDa Observed Molecular Weight: 24 kDa GenBank Accession Number: BC039858 Gene Symbol: RALA Gene ID (NCBI): 5898 RRID: AB_2882398 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P11233 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924