Proteintech, 67094-1-Ig, RALB Monoclonal antibody

Size: 20ul / 150ul The RALB (67094-1-Ig) by Proteintech is a Monoclonal antibody targeting RALB in WB, IHC, IF-P, ELISA applications with reactivity to Human, rat, pig, mouse samples 67094-1-Ig targets RALB in WB, IHC, IF-P, ELISA applications and shows reactivity with Human, rat, pig, mouse samples. Tested Applications Positive WB detected in: HeLa cells, rat brain tissue, mouse brain tissue, MCF-7 cells, HepG2 cells, Jurkat cells, Pig brain cells Positive IHC detected in: mouse bladder tissue, human lung cancer tissue, mouse liver tissue, mouse lung tissue, mouse placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human lung cancer tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)-P: IF-P : 1:400-1:1600 Specification Tested Reactivity: Human, rat, pig, mouse Cited Reactivity: human Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Affinity: K D =1.82 x 10 -10 M K Off =2.54 x 10 -6 M K On =1.40 x 10 4 M Immunogen: CatNo: Ag28600 Product name: Recombinant human RALB protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-206 aa of BC018163 Sequence: MAANKSKGQSSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLLVFSITEHESFTATAEFREQILRVKAEEDKIPLLVVGNKSDLEERRQVPVEEARSKAEEWGVQYVETSAKTRANVDKVFFDLMREIRTKKMSENKDKNGKKSSKNKKSFKERCCLL Predict reactive species Full Name: v-ral simian leukemia viral oncogene homolog B (ras related; GTP binding protein) Calculated Molecular Weight: 206 aa, 23 kDa Observed Molecular Weight: 24 kDa GenBank Accession Number: BC018163 Gene Symbol: RALB Gene ID (NCBI): 5899 RRID: AB_2882399 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P11234 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.