Proteintech, 67096-1-Ig, ATG9A Monoclonal antibody

Size: 20ul / 150ul The ATG9A (67096-1-Ig) by Proteintech is a Monoclonal antibody targeting ATG9A in WB, IHC, IF/ICC, ELISA applications with reactivity to Human samples 67096-1-Ig targets ATG9A in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: HEK-293 cells, HepG2 cells, Jurkat cells Positive IHC detected in: human thyroid cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:300-1:1200 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information ATG9A is the only transmembrane ATG protein essential for autophagy. It plays a key role in the organization of the preautophagosomal structure/phagophore assembly site (PAS). It has been reported that ATG9A expression is increased in oral squamous cell carcinoma and breast cancers. The inhibition of ATG9A can lead to an inhibition of cancer cell proliferation and invasion.(PMID: 29437695, 29568063) Specification Tested Reactivity: Human Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag24278 Product name: Recombinant human ATG9A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 427-528 aa of BC065534 Sequence: DQHMVFCPEQLLRVILAHIHYMPDHWQGVHFGRVAEPHCHTPHPHLLPAPTGPGDYRLLPKLHRGGRWCGRYLLLCSDGCSPAWSSPVAICWADRGLSVPAS Predict reactive species Full Name: ATG9 autophagy related 9 homolog A (S. cerevisiae) Calculated Molecular Weight: 837 aa, 94 kDa Observed Molecular Weight: 94 kDa GenBank Accession Number: BC065534 Gene Symbol: ATG9A Gene ID (NCBI): 79065 RRID: AB_2882401 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q7Z3C6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.