Iright
BRAND / VENDOR: Proteintech

Proteintech, 67098-1-Ig, NEU3 Monoclonal antibody

CATALOG NUMBER: 67098-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The NEU3 (67098-1-Ig) by Proteintech is a Monoclonal antibody targeting NEU3 in WB, IHC, ELISA applications with reactivity to Human samples 67098-1-Ig targets NEU3 in WB, IHC, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: PC-3 cells, COLO 320 cells, HT-29 cells, K-562 cells, THP-1 cells, Caco-2 cells Positive IHC detected in: human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: Human Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag27272 Product name: Recombinant human NEU3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 193-326 aa of NM_006656.5 Sequence: MPCKTRPHSLMIYSDDLGVTWHHGRLIRPMVTVECEVAEVTGRAGHPVLYCSARTPNRCRAEALSTDHGEGFQRLALSRQLCEPPHGCQGSVVSFRPLEIPHRCQDSSSKDAPTIQQSSPGSSLRLEEEAGTPSE Predict reactive species Full Name: sialidase 3 (membrane sialidase) Calculated Molecular Weight: 48 kDa Observed Molecular Weight: 48-52 kDa GenBank Accession Number: NM_006656.5 Gene Symbol: NEU3 Gene ID (NCBI): 10825 RRID: AB_2882403 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9UQ49 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924