Iright
BRAND / VENDOR: Proteintech

Proteintech, 67111-1-Ig, DLX5 Monoclonal antibody

CATALOG NUMBER: 67111-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The DLX5 (67111-1-Ig) by Proteintech is a Monoclonal antibody targeting DLX5 in WB, IHC, ELISA applications with reactivity to human, mouse, rat, pig samples 67111-1-Ig targets DLX5 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: PC-12 cells, A375 cells, U-251 cells, THP-1 cells, pig brain tissue, rat brain tissue, mouse brain tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information DLX5 belongs to the DLX family of homeobox transcription factors (Dlx1, Dlx2, Dlx5 and Dlx6), which is expressed in overlapping domains at different stages of cell differentiation in the subpallium and controls differentiation of GABAergic neurons. DLX5 is an immediate early BMP-responsive transcriptional activator that essential for osteoblast differentiation. It can bind to and stimulate the homeodomain-response element of the ALPL and SP7 promoter. DLX5 can form homodimer with DLX2(~34kd) and heterodimer with MSX2(~29kd). Specification Tested Reactivity: human, mouse, rat, pig Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag17040 Product name: Recombinant human DLX5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-289 aa of BC006226 Sequence: MTGVFDRRVPSIRSGDFQAPFQTSAAMHHPSQESPTLPESSATDSDYYSPTGGAPHGYCSPTSASYGKALNPYQYQYHGVNGSAGSYPAKAYADYSYASSYHQYGGAYNRVPSATNQPEKEVTEPEVRMVNGKPKKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWFQNKRSKIKKIMKNGEMPPEHSPSSSDPMACNSPQSPAVWEPQGSSRSLSHHPHAHPPTSNQSPASSYLENSASWYTSAASSINSHLPPPGSLQHPLALASGTLY Predict reactive species Full Name: distal-less homeobox 5 Calculated Molecular Weight: 32 kDa Observed Molecular Weight: 33-38 kDa GenBank Accession Number: BC006226 Gene Symbol: DLX5 Gene ID (NCBI): 1749 RRID: AB_2882415 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P56178 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924