Iright
BRAND / VENDOR: Proteintech

Proteintech, 67116-1-Ig, VEGF-C Monoclonal antibody

CATALOG NUMBER: 67116-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The VEGF-C (67116-1-Ig) by Proteintech is a Monoclonal antibody targeting VEGF-C in WB, IF/ICC, ELISA applications with reactivity to human samples 67116-1-Ig targets VEGF-C in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MCF-7 cells, T-47D cells, NCI-H1299 cells, A549 cells, LNCaP cells, HT-1080 cells Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information VEGFC is a member of the platelet-derived growth factor / vascular endothelial growth factor (PDGF/VEGF) family. The main function of VEGFC is to promote the growth of lymphatic vessels (lymphangiogenesis). It acts on lymphatic endothelial cells (LECs) primarily via its receptor VEGFR-3 promoting survival, growth, and migration. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag18182 Product name: Recombinant human VEGFC protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 179-228 aa of BC035212 Sequence: SYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRRS Predict reactive species Full Name: vascular endothelial growth factor C Calculated Molecular Weight: 419 aa, 47 kDa Observed Molecular Weight: 47 kDa GenBank Accession Number: BC035212 Gene Symbol: VEGFC Gene ID (NCBI): 7424 RRID: AB_2882420 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P49767 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924