Iright
BRAND / VENDOR: Proteintech

Proteintech, 67135-2-Ig, CD33 Monoclonal antibody

CATALOG NUMBER: 67135-2-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CD33 (67135-2-Ig) by Proteintech is a Monoclonal antibody targeting CD33 in WB, ELISA applications with reactivity to Human samples 67135-2-Ig targets CD33 in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: Mo7e cells, THP-1 cells, U-937 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information CD33, also referred to as Siglec-3, is a 67-kDa glycosylated transmembrane protein of sialic acid-binding immunoglobulin-like lactic (siglec) family. CD33 is expressed on monocytes, myeloid progenitors, granulocytes, mast cells, some T cells. It may mediate cell-to-cell adhesion and act as a receptor that inhibits the proliferation of normal and leukemic myeloid cells. Specification Tested Reactivity: Human Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag11402 Product name: Recombinant human CD33 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 49-259 aa of BC028152 Sequence: YYDKNSPVHGYWFREGAIISGDSPVATNKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRMERGSTKYSYKSPQLSVHVTDLTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWLSAAPTSLGPRTTHSSVLIITPRPQDHGTNLTCQVKFAGAGVTTERTIQLNVTYVPQNPTTGIFPGDGSGKQETRAGVVH Predict reactive species Full Name: CD33 molecule Calculated Molecular Weight: 364 aa, 40 kDa Observed Molecular Weight: 67-70 kDa GenBank Accession Number: BC028152 Gene Symbol: CD33 Gene ID (NCBI): 945 RRID: AB_3085036 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P20138 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924