Proteintech, 67174-1-Ig, RAP1B Monoclonal antibody

Size: 20ul / 150ul The RAP1B (67174-1-Ig) by Proteintech is a Monoclonal antibody targeting RAP1B in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 67174-1-Ig targets RAP1B in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HSC-T6 cells, NIH/3T3 cells, 4T1 cells, HEK-293 cells, HepG2 cells, Jurkat cells Positive IHC detected in: human oesophagus cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:8000 Immunohistochemistry (IHC): IHC : 1:50-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag29212 Product name: Recombinant human RAP1B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-184 aa of BC000176 Sequence: MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKARKKSSCQLL Predict reactive species Full Name: RAP1B, member of RAS oncogene family Calculated Molecular Weight: 21 kDa Observed Molecular Weight: 21 kDa GenBank Accession Number: BC000176 Gene Symbol: RAP1B Gene ID (NCBI): 5908 RRID: AB_2882470 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P61224 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.