Iright
BRAND / VENDOR: Proteintech

Proteintech, 67190-1-Ig, KIF20A Monoclonal antibody

CATALOG NUMBER: 67190-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The KIF20A (67190-1-Ig) by Proteintech is a Monoclonal antibody targeting KIF20A in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 67190-1-Ig targets KIF20A in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells, HeLa cells, MG-63 cells, HEK-293 cells, Jurkat cells, HL-60 cells, HSC-T6 cells, PC-12 cells, NIH/3T3 cells, BT-549 cells, MDA-MB-468 cells Positive IHC detected in: human breast cancer tissue, human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information KIF20A, also known as RAB6KIFL or MKlp2, is a kinesin originally identified as a binding partner for the rab6 GTPase involved in protein transport at the Golgi apparatus. KIF20A belongs to a large family of motor proteins that accumulate in mitotic cells and is required for normal cell division. KIF20A is thought to be involved in carcinogenesis. In normal tissues KIF20A is almost undetectable while it is overexpressed in various cancers. KIF20A has been identified as a novel promising candidate for anticancer immunotherapy. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag8916 Product name: Recombinant human KIF20A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-351 aa of BC012999 Sequence: MSQGILSPPAGLLSDDDVVVSPMFESTAADLGSVVRKNLLSDCSVVSTSLEDKQQVPSEDSMEKVKVYLRVRPLLPSELERQEDQGCVRIENVETLVLQAPKDSFALKSNERGIGQATHRFTFSQIFGPEVGQASFFNLTVKEMVKDVLKGQNWLIYTYGVTNSGKTHTIQGTIKDGGILPRSLALIFNSLQGQLHPTPDLKPLLSNEVIWLDSKQIRQEEMKKLSLLNGGLQEEELSTSLKRSVYIESRIGTSTSFDSGIAGLSSISQCTSSSQLDETSHRWAQPDTAPLPVPANIRFSIWISFFEIYNELLYDLLEPPSQQRKRQTLRLCEDQNGNPYVKDLNWIHVQD Predict reactive species Full Name: kinesin family member 20A Calculated Molecular Weight: 890 aa, 100 kDa Observed Molecular Weight: 100 kDa GenBank Accession Number: BC012999 Gene Symbol: KIF20A Gene ID (NCBI): 10112 RRID: AB_2882485 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: O95235 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924