Proteintech, 67205-1-Ig, TMEM111 Monoclonal antibody

Size: 20ul / 150ul The TMEM111 (67205-1-Ig) by Proteintech is a Monoclonal antibody targeting TMEM111 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat, pig samples 67205-1-Ig targets TMEM111 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, human heart tissue, pig heart tissue, rat heart tissue, mouse heart tissue, HepG2 cells, Jurkat cells, HSC-T6, NIH/3T3 cells, 4T1 cells Positive IHC detected in: mouse lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information TMEM111,also names as EMC3, is part of the endoplasmic reticulum-associated secretory pathway (PMID: 19797678). TMEM111 was required for murine pulmonary surfactant synthesis and lung function at birth (PMID: 29083321). It can be detect a band of 30 kDa. Specification Tested Reactivity: human, mouse, rat, pig Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag18365 Product name: Recombinant human TMEM111 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 139-261 aa of BC022807 Sequence: KVPFPLTLRFKPMLQQGIELLTLDASWVSSASWYFLNVFGLRSIYSLILGQDNAADQSRMMQEQMTGAAMAMPADTNKAFKTEWEALELTDHQWALDDVEEELMAKDLHFEGMFKKELQTSIF Predict reactive species Full Name: transmembrane protein 111 Calculated Molecular Weight: 261 aa, 30 kDa Observed Molecular Weight: 30 kDa GenBank Accession Number: BC022807 Gene Symbol: TMEM111 Gene ID (NCBI): 55831 RRID: AB_2882498 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9P0I2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.