Iright
BRAND / VENDOR: Proteintech

Proteintech, 67210-1-Ig, WNT10B Monoclonal antibody

CATALOG NUMBER: 67210-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The WNT10B (67210-1-Ig) by Proteintech is a Monoclonal antibody targeting WNT10B in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 67210-1-Ig targets WNT10B in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: NCCIT cells, MCF-7 cells, NCI-H1299 cells, human heart tissue, pig heart tissue, rat heart tissue, mouse heart tissue Positive IHC detected in: mouse liver tissue, mouse skeletal muscle tissue, human heart tissue, mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:150-1:600 Background Information Wnt10b is a member of the Wnt ligand gene family that encodes for secreted proteins, which activate the ancient and highly conserved Wnt signalling cascade. This antibody can be detected a band of 43 kDa. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag17114 Product name: Recombinant human WNT10B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 19-204 aa of BC096353 Sequence: FLALCSRALSNEILGLKLPGEPPLTANTVCLTLSGLSKRQLGLCLRNPDVTASALQGLHIAVHECQHQLRDQRWNCSALEGGGRLPHHSAILKRGFRESAFSFSMLAAGVMHAVATACSLGKLVSCGCGWKGSGEQDRLRAKLLQLQALSRGKSFPHSLPSPGPGSSPSPGPQDTWEWGGCNHDMD Predict reactive species Full Name: wingless-type MMTV integration site family, member 10B Calculated Molecular Weight: 389 aa, 43 kDa Observed Molecular Weight: 43 kDa GenBank Accession Number: BC096353 Gene Symbol: WNT10B Gene ID (NCBI): 7480 RRID: AB_2882503 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: O00744 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924