Proteintech, 67211-1-Ig, TBK1 Monoclonal antibody

Size: 20ul / 150ul The TBK1 (67211-1-Ig) by Proteintech is a Monoclonal antibody targeting TBK1 in WB, ELISA applications with reactivity to human, rat samples 67211-1-Ig targets TBK1 in WB, IF, IP, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, U2OS cells, HepG2 cells, Jurkat cells, LNCaP cells, HSC-T6 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information TBK1, also named as tumor necrosis factor (TNF) receptor-associated factor NF-kB activator (TANK)-binding kinase 1 (TBK1), NF-kB-activating kinase (NAK), T2K, is a multimeric kinase that modulates inflammation and autophagy. It is a ubiquitously expressed serine-threonine kinase belonging to the 'noncanonical IkB kinases' (IKKs) recognized for its critical role in regulating type I IFN production (PMID: 27211305). And TBK1 is an important player in yet another critical cellular function, autophagy. This antibody is specific for TBK1. Specification Tested Reactivity: human, rat Cited Reactivity: human, mouse, rat, pig Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag28894 Product name: Recombinant human TBK1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 316-576 aa of BC034950 Sequence: LQQMTAHKIYIHSYNTATIFHELVYKQTKIISSNQELIYEGRRLVLEPGRLAQHFPKTTEENPIFVVSREPLNTIGLIYEKISLPKVHPRYDLDGDASMAKAITGVVCYACRIASTLLLYQELMRKGIRWLIELIKDDYNETVHKKTEVVITLDFCIRNIEKTVKVYEKLMKINLEAAELGEISDIHTKLLRLSSSQGTIETSLQDIDSRLSPGGSLADAWAHQEGTHPKDRNVEKLQVLLNCMTEIYYQFKKDKAERRLA Predict reactive species Full Name: TANK-binding kinase 1 Observed Molecular Weight: 84 kDa GenBank Accession Number: BC034950 Gene Symbol: TBK1 Gene ID (NCBI): 29110 RRID: AB_2882504 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9UHD2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.