Proteintech, 67213-1-Ig, RHOQ/TC10 Monoclonal antibody

Size: 20ul / 150ul The RHOQ/TC10 (67213-1-Ig) by Proteintech is a Monoclonal antibody targeting RHOQ/TC10 in WB, IHC, ELISA applications with reactivity to Human, mouse, rat, pig samples 67213-1-Ig targets RHOQ/TC10 in WB, IHC, ELISA applications and shows reactivity with Human, mouse, rat, pig samples. Tested Applications Positive WB detected in: HEK-293 cells, mouse brain tissue, rat brain tissue, pig brain tissue, fetal human brain tissue, Jurkat cells, A549 cells Positive IHC detected in: mouse liver tissue, human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:8000-1:32000 Specification Tested Reactivity: Human, mouse, rat, pig Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag12078 Product name: Recombinant human RHOQ protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-205 aa of BC070485 Sequence: MAHGPGALMLKCVVVGDGAVGKTCLLMSYANDAFPEEYVPTVFDHYAVSVTVGGKQYLLGLYDTAGQEDYDRLRPLSYPMTDVFLICFSVVNPASFQNVKEEWVPELKEYAPNVPFLLIGTQIDLRDDPKTLARLNDMKEKPICVEQGQKLAKEIGACCYVECSALTQKGLKTVFDEAIIAILTPKKHTVKKRIGSRCINCCLIT Predict reactive species Full Name: ras homolog gene family, member Q Calculated Molecular Weight: 205 aa, 23 kDa Observed Molecular Weight: 20-23 kDa GenBank Accession Number: BC070485 Gene Symbol: RHOQ/TC10 Gene ID (NCBI): 23433 RRID: AB_2882505 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P17081 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.