Iright
BRAND / VENDOR: Proteintech

Proteintech, 67214-1-Ig, EIF5A Monoclonal antibody

CATALOG NUMBER: 67214-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The EIF5A (67214-1-Ig) by Proteintech is a Monoclonal antibody targeting EIF5A in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 67214-1-Ig targets EIF5A in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293T cells, LNCaP cells, Jurkat cells, NIH/3T3 cells, HEK-293 cells, PC-3 cells, HSC-T6 cells, RAW 264.7 cells, HaCaT cells, HepG2 cells, SK-BR-3 cells Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information Translation of messenger RNA (mRNA) to protein in eukaryotesis a crucial process in protein biosynthesis, in which initiation of translation involves interaction of different eukaryotic translation initiation factors (eIFs), ribosome subunits and mRNAs. Eukaryotic translation initiation factor 5A (EIF5A) is one of the eIFs involved in translation initiation. EIF5A has a essential role in cell viability and the only protein known to contain the amino acid residue hypusine, formed by post-translational modification of a specific lysine residue. Firstly identified as a translation initiation factor, it also has a function in the elongation step of translation. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag28588 Product name: Recombinant human EIF5A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-154 aa of BC001832 Sequence: MADDLDFETGDAGASATFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDFQLIGIQDGYLSLLQDSGEVREDLRLPEGDLGKEIEQKYDCGEEILITVLSAMTEEAAVAIKAMAK Predict reactive species Full Name: eukaryotic translation initiation factor 5A Calculated Molecular Weight: 18 kDa Observed Molecular Weight: 18 kDa GenBank Accession Number: BC001832 Gene Symbol: EIF5A Gene ID (NCBI): 1984 RRID: AB_2882506 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P63241 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924