Product Description
Size: 20ul / 150ul
The MRP1 (67228-1-Ig) by Proteintech is a Monoclonal antibody targeting MRP1 in WB, IF/ICC, ELISA applications with reactivity to human samples
67228-1-Ig targets MRP1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: unboiled HepG2 cells, unboiled A549 cells
Positive IF/ICC detected in: A549 cells
Recommended dilution
Western Blot (WB): WB : 1:5000-1:50000
Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800
Background Information
Multidrug resistant-associated protein 1 (MRP1; ABCC1) is a member of the ATP-binding cassette (ABC) transporter protein superfamily, subfamily C. MRP1 is overexpressed in cancers and contributes to the occurrence of multidrug resistance (MDR). Expression of MRP1 has been considered as a negative marker for the outcome of chemotherapy. Recently MRP1 has been reported to play a crucial role in Aβ clearance at the blood-brain barrier.
Specification
Tested Reactivity: human
Cited Reactivity: human, mouse
Host / Isotype: Mouse / IgG1
Class: Monoclonal
Type: Antibody
Immunogen: CatNo: Ag27048 Product name: Recombinant human ABCC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 918-1025 aa of NM_004996 Sequence: SSYSGDISRHHNSTAELQKAEAKKEETWKLMEADKAQTGQVKLSVYWDYMKAIGLFISFLSIFLFMCNHVSALASNYWLSLWTDDPIVNGTQEHTKVRLSVYGALGIS Predict reactive species
Full Name: ATP-binding cassette, sub-family C (CFTR/MRP), member 1
Calculated Molecular Weight: 172 kDa
Observed Molecular Weight: 180-190 kDa
GenBank Accession Number: NM_004996
Gene Symbol: MRP1
Gene ID (NCBI): 4363
RRID: AB_2882516
Conjugate: Unconjugated
Form: Liquid
Purification Method: Protein G purification
UNIPROT ID: P33527
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924