Iright
BRAND / VENDOR: Proteintech

Proteintech, 67237-1-Ig, S100A1 Monoclonal antibody

CATALOG NUMBER: 67237-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The S100A1 (67237-1-Ig) by Proteintech is a Monoclonal antibody targeting S100A1 in IHC, ELISA applications with reactivity to human, rat samples 67237-1-Ig targets S100A1 in IHC, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive IHC detected in: human tonsillitis tissue, rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:16000-1:64000 Specification Tested Reactivity: human, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag19544 Product name: Recombinant human S100A1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-94 aa of BC014392 Sequence: MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS Predict reactive species Full Name: S100 calcium binding protein A1 Calculated Molecular Weight: 94 aa, 11 kDa GenBank Accession Number: BC014392 Gene Symbol: S100A1 Gene ID (NCBI): 6271 RRID: AB_3085037 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P23297 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924